PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0174s00170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 80aa    MW: 9448.79 Da    PI: 11.1724
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0174s00170.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding64.12.6e-202467146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                      r ++T+eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ 
  Vang0174s00170.1 24 RRPFTEEEEERLLAAHRIHGNK-WALIARLFP-GRTDNAVKNHWHV 67
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.63E-24774IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-10731IPR009057Homeodomain-like
PROSITE profilePS5129428.3661973IPR017930Myb domain
SMARTSM007172.4E-162371IPR001005SANT/Myb domain
PfamPF002494.2E-172466IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-193267IPR009057Homeodomain-like
CDDcd001671.66E-73566No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MEDSSAGKSC RLRWFNQLDP RINRRPFTEE EEERLLAAHR IHGNKWALIA RLFPGRTDNA  60
VKNHWHVIMA RKQREQSKL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-2277242107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-120AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007019337.12e-48Myb domain protein 52
SwissprotQ9FDW17e-25MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A061FIQ02e-48A0A061FIQ0_THECC; Myb domain protein 52
STRINGGLYMA04G42110.22e-47(Glycine max)
STRINGGLYMA06G12691.12e-47(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.13e-41myb domain protein 52